PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim09g008810.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 242aa    MW: 27998.4 Da    PI: 8.3764
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim09g008810.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.27.5e-2069121456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         + +++++qle Le+ F+++ +++ +++ +LAk+lgL+ rq+ vWFqNrRa++k
  Sopim09g008810.0.1  69 KKRLSSDQLESLENSFQEEIKLDPDRKMKLAKELGLQPRQIAVWFQNRRARWK 121
                         55699***********************************************9 PP

2HD-ZIP_I/II120.21.1e-3868159293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         kk+rls++q+++LE+sF+ee kL+p+rK++la+eLglqprq+avWFqnrRAR+k+kqlE+ y++Lk+ yd +++e+++L++ev +Lr+ lk
  Sopim09g008810.0.1  68 KKKRLSSDQLESLENSFQEEIKLDPDRKMKLAKELGLQPRQIAVWFQNRRARWKAKQLERLYDSLKQDYDVVSREKQKLQDEVLALRAILK 158
                         9**************************************************************************************8887 PP

         HD-ZIP_I/II  93 e 93 
                         e
  Sopim09g008810.0.1 159 E 159
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.55E-1950125IPR009057Homeodomain-like
PROSITE profilePS5007117.31363123IPR001356Homeobox domain
SMARTSM003893.6E-1765127IPR001356Homeobox domain
PfamPF000463.6E-1768121IPR001356Homeobox domain
CDDcd000862.32E-1668124No hitNo description
Gene3DG3DSA:1.10.10.602.4E-2170130IPR009057Homeodomain-like
PRINTSPR000317.3E-694103IPR000047Helix-turn-helix motif
PROSITE patternPS00027098121IPR017970Homeobox, conserved site
PRINTSPR000317.3E-6103119IPR000047Helix-turn-helix motif
PfamPF021832.1E-7123157IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010434Biological Processbract formation
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MDWNGNIRPF VSRQVIDNSL NFLYNYNYDQ YPGIEMKHAM QTQHGGVQVP TMDNNNNNFV  60
LNQHQLDKKK RLSSDQLESL ENSFQEEIKL DPDRKMKLAK ELGLQPRQIA VWFQNRRARW  120
KAKQLERLYD SLKQDYDVVS REKQKLQDEV LALRAILKEQ ATKKQVNSTV YTEISGEETV  180
ESTSMPSSNK TITRGVTISN HQNNNINNNN NIAECSYVFN NVVDGLNPVM PPYWATLPTY  240
P*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115123RRARWKAKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00486DAPTransfer from AT5G03790Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755210.0HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004246902.10.0PREDICTED: putative homeobox-leucine zipper protein ATHB-51
SwissprotQ9LZR09e-56ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLK4CQR60.0K4CQR6_SOLLC; Uncharacterized protein
STRINGSolyc09g008810.2.11e-180(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38692246
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.13e-56homeobox 51